Effets secondaires minimaux d'amélioration de muscle de bodybuilding de peptides de la croissance CJC-1295 avec DAC

Détails sur le produit:
Lieu d'origine: La Chine
Nom de marque: FILTER
Certification: GMP
Numéro de modèle: 863288-34-0
Conditions de paiement et expédition:
Quantité de commande min: 10 fioles
Prix: Negotiable
Détails d'emballage: 5mg/vial, 10mg/vial ou au besoin
Délai de livraison: dans les 7 jours ouvrables
Conditions de paiement: L/C, T/T, Western Union, MoneyGram, Alipay
Capacité d'approvisionnement: 100000vials/month

Détail Infomation

Spécification: 2mg/vial Apparence: poudre blanche
DeliveryTime: dans les 7 jours ouvrables Port: Changhaï/Guangzhou/Hong Kong
Paquet: Icebag, manières discrètes d'emballage pour votre référence LimitNum: 10 fioles
Pureté: 99% Transport: DHL, Fedix, HKEMS, HKEUB, TNT
Stockage: endroit sec, foncé et aéré
Surligner:

growth hormone peptides

,

human growth hormone supplements

Description de produit

peptide Cjc-1295 du bodybuilding 2/5/10mg/Vial avec Dac CAS 863288-34-0

 

Description

Nom de produit :

CJC1295

Synonymes :

CJC1295 ; Y (d - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 ; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl) - 1-oxopropyl] - L-lysinamide ; Acétate CJC-1295 ; CJC1295 avec DAC

CAS :

863288-34-0

MF :

C159H258N46O45

MW :

0

EINECS :

 

Catégories de produit :

Peptides

 

 

Que devrait être noté ?
1. Puisque CJC-1295 est juste un peptide et pas un stéroïde, il a des effets secondaires très minimaux. Les gens employant les doses élevées de ce peptide peuvent éprouver des effets secondaires doux comme de longs rêves qu'ils peuvent se rappeler clairement, mains et doigts allant des maux engourdis et mats dans les joints, et faiblesse aussi bien que distraction si assez d'hydrates de carbone ne sont pas consommés.
2. Un autre effet secondaire du CJC-1295 est acromégalie, puisqu'il aide en augmentant les niveaux de l'hormone. L'acromégalie est une condition où l'hormone de croissance supplémentaire est libérée même après que les organes internes et le squelette ont fini l'élevage. Ceci cause l'épaississement de la peau, l'approfondissement de la voix, l'élargissement des mâchoires, et slurring de la parole. Un autre effet d'acromégalie est le gonflement du tissu mou dans les organes internes. Ceci a pu avoir comme conséquence l'affaiblissement des muscles des organes internes, comme le coeur. Ceci a été examiné pendant l'essai de la phase 2 de CJC-1295.

 

Notre processus :
Le processus de contrôle de qualité
1) achat
La recherche de marché complète, comprennent le prix des matières premières et de la représentation. À la source de fourniture à comprendre entièrement, et pour garantir entièrement la qualité de la fourniture des matières premières.
2) inspection
Quatre étapes : échantillonnage, traitement préparatoire d'échantillon, mesure et informatique.
3) production
a) chaque opérateur doit faire l'auto-inspection des producs et noter correspondants inspection.
b) les inspecteurs à plein temps vérifient l'auto-inspection d'opérateur, et l'examen et signent dedans le disque correspondant. L'inspection à plein temps est responsable de l'inspection du produit fini, et note au produit fini entrants inspection.
4) avant la vente
Le résultat d'essai peut être fourni avant la vente.
On permet le tiers établissement de détection si vous n'êtes pas satisfait des résultats d'essai.


Nos avantages :
1. qualité :
Notre société est une production professionnelle des intermédiaires d'hormone depuis de nombreuses années, nos produits ont exporté vers l'Allemagne, Espagne, R-U, Etats-Unis, Australie, Moyen-Orient, et ainsi de suite l'autre pays, et nous avons le retour très bon de nos clients, vous pouvons nous faire confiance.
Et nous sommes l'usine, ainsi aucun problème pour que nous commandent la qualité.
2. méthode de paiement : Western Union, TTT.
3. service : Le meilleur service avec le service après-vente à tous les clients.
4. la livraison :
Ordre d'échantillon : Le paquet sera embarqué avec 3days après paiement. Nous pouvons l'envoyer par l'intermédiaire de, SME, HK aérons le courrier, le DHL ou l'othermethod. Nous avons une logistique professionnelle et stable, et nous pouvons fournir le paquet sans à-coup environ 3 à 5 jours.
L'autre peptide notre approvisionnement de laboratoire :

Effets secondaires minimaux d'amélioration de muscle de bodybuilding de peptides de la croissance CJC-1295 avec DAC 0

 

Effets secondaires minimaux d'amélioration de muscle de bodybuilding de peptides de la croissance CJC-1295 avec DAC 1
 

Prenez contact avec nous

Entrez votre message

Vous pourriez être dans ces